Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crlf1, Mouse (HEK293, His, solution)

Crlf1 protein combines with CLCF1 to form an important neurotrophic cytokine involved in neuronal development. It plays a crucial role in the initiation and maintenance of lactation in neonatal mice and is associated with immune system regulation. Crlf1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Crlf1 protein, expressed by HEK293 , with His labeled tag.

Product Specifications

Product Name Alternative

Crlf1 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crlf1-mouse-hek293-his.html

Purity

90.0

Smiles

GAHTAVISPQDPTLLIGSSLQATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGVCEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGAARGPAG

Molecular Formula

12931 (Gene_ID) Q9JM58 (G40-G425) (Accession)

Molecular Weight

Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Type 1 Fimbrin D-mannose Specific Adhesin, Recombinant, E. coli, aa22-300, SKIK-Tag, His-Tag
586678-01 20 µg

Type 1 Fimbrin D-mannose Specific Adhesin, Recombinant, E. coli, aa22-300, SKIK-Tag, His-Tag

Sign In for Pricing
View Details
Type 1 Fimbrin D-mannose Specific Adhesin, Recombinant, E. coli, aa22-300, SKIK-Tag, His-Tag
586678-02 100 µg

Type 1 Fimbrin D-mannose Specific Adhesin, Recombinant, E. coli, aa22-300, SKIK-Tag, His-Tag

Sign In for Pricing
View Details
Methyl Oxindole-6-carboxylate
455971-01 250 mg

Methyl Oxindole-6-carboxylate

Sign In for Pricing
View Details
Methyl Oxindole-6-carboxylate
455971-02 1 g

Methyl Oxindole-6-carboxylate

Sign In for Pricing
View Details
Lentiviral human LCTL shRNA (UAS) - Lentiviral human LCTL shRNA (UAS, RFP) (25)
GTR15098819 1 Vial

Lentiviral human LCTL shRNA (UAS) - Lentiviral human LCTL shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CD210 Mouse mAb Antibody
orb3064552-01 50 µL

CD210 Mouse mAb Antibody

Sign In for Pricing
View Details