Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crlf1, Mouse (HEK293, His, solution)

Crlf1 protein combines with CLCF1 to form an important neurotrophic cytokine involved in neuronal development. It plays a crucial role in the initiation and maintenance of lactation in neonatal mice and is associated with immune system regulation. Crlf1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Crlf1 protein, expressed by HEK293 , with His labeled tag.

Product Specifications

Product Name Alternative

Crlf1 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crlf1-mouse-hek293-his.html

Purity

90.0

Smiles

GAHTAVISPQDPTLLIGSSLQATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGVCEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGAARGPAG

Molecular Formula

12931 (Gene_ID) Q9JM58 (G40-G425) (Accession)

Molecular Weight

Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC497860 Protein Vector (Rat) (pPM-C-His)
PV278537 500 ng

LOC497860 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Transcription Elongation Factor SPT5 (SUPT5H) Antibody
abx028120-01 80 µL

Transcription Elongation Factor SPT5 (SUPT5H) Antibody

Sign In for Pricing
View Details
Transcription Elongation Factor SPT5 (SUPT5H) Antibody
abx028120-02 400 µL

Transcription Elongation Factor SPT5 (SUPT5H) Antibody

Sign In for Pricing
View Details
GPR91 Blocking Peptide
MBS9617020-01 1 mg

GPR91 Blocking Peptide

Sign In for Pricing
View Details
GPR91 Blocking Peptide
MBS9617020-02 5x 1 mg

GPR91 Blocking Peptide

Sign In for Pricing
View Details
Research Grade Onfekafusp Alfa
DHK09501 100 μg

Research Grade Onfekafusp Alfa

Sign In for Pricing
View Details