Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPMT1, Human (His)

The PTPMT1 protein is a lipid phosphatase that critically regulates cellular lipid metabolism by dephosphorylating phosphatidylglycerolphosphate (PGP) to form phosphatidylglycerol (PG) . This step is critical for the biosynthesis of cardiolipin, a key mitochondrial phospholipid that regulates membrane integrity and mitochondrial activity. PTPMT1 Protein, Human (His) is the recombinant human-derived PTPMT1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PTPMT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptpmt1-protein-human-his.html

Purity

98.0

Smiles

KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

Molecular Formula

114971 (Gene_ID) Q8WUK0-1 (K28-T201) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CASQ2 (Calsequestrin-2, Calsequestrin, Cardiac Muscle Isoform) (MaxLight 650)
MBS6372308-01 0.1 mL

CASQ2 (Calsequestrin-2, Calsequestrin, Cardiac Muscle Isoform) (MaxLight 650)

Ask
View Details
CASQ2 (Calsequestrin-2, Calsequestrin, Cardiac Muscle Isoform) (MaxLight 650)
MBS6372308-02 5x 0.1 mL

CASQ2 (Calsequestrin-2, Calsequestrin, Cardiac Muscle Isoform) (MaxLight 650)

Ask
View Details
APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2) (MaxLight 750) discontinued
217184-ML750 100 µL

APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2) (MaxLight 750) discontinued

Ask
View Details
Lentiviral mouse Rnf150 shRNA (UAS) - Lentiviral mouse Rnf150 shRNA (UAS, GFP) (100)
GTR15156681 1 Vial

Lentiviral mouse Rnf150 shRNA (UAS) - Lentiviral mouse Rnf150 shRNA (UAS, GFP) (100)

Ask
View Details
Lentiviral human C1orf131 sgRNA gene knockout kit - Lentiviral human C1orf131 sgRNA gene knockout kit (plasmid)
GTR15394661 1 Vial

Lentiviral human C1orf131 sgRNA gene knockout kit - Lentiviral human C1orf131 sgRNA gene knockout kit (plasmid)

Ask
View Details