Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 11 protein (CXCL11) (Active)

Product Specifications

Product Name Alternative

Beta-R1, Interferon gamma-inducible protein 9, IP-9, Interferon-inducible T-cell alpha chemoattractant, I-TAC

Abbreviation

Recombinant Human CXCL11 protein (Active)

Gene Name

CXCL11

UniProt

O14625

Expression Region

22-94aa

Organism

Homo sapiens (Human)

Target Sequence

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human IL-2 activated human T-lymphocytes is in a concentration range of 0.1-10 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.

Molecular Weight

8.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF740 conjugate, 0.1mg/mL
BNC741878-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details