Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urocortin 3 (UCN3) Antibody Pair
abx370899-01 5x 96 Tests

Urocortin 3 (UCN3) Antibody Pair

Sign In for Pricing
View Details
Urocortin 3 (UCN3) Antibody Pair
abx370899-02 10x 96 Tests

Urocortin 3 (UCN3) Antibody Pair

Sign In for Pricing
View Details
NFkB-p105, phosphorylated (S927) (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued
224505-01 50 µL

NFkB-p105, phosphorylated (S927) (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued

Sign In for Pricing
View Details
NFkB-p105, phosphorylated (S927) (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued
224505-02 100 µL

NFkB-p105, phosphorylated (S927) (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued

Sign In for Pricing
View Details
SNORD114-27 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44719151 3x 1.0 µg DNA

SNORD114-27 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
RPS12P24 ORF Vector (Human) (pORF)
ORF031211 1.0 µg DNA

RPS12P24 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details