Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AEBP2, CT (AEBP2, Zinc finger protein AEBP2, Adipocyte enhancer-binding protein 2) (MaxLight 405) discontinued
031668-ML405 100 µL

AEBP2, CT (AEBP2, Zinc finger protein AEBP2, Adipocyte enhancer-binding protein 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PDIA3 sgRNA CRISPR Lentivector (Human) (Target 2)
K1621303 1.0 µg DNA

PDIA3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human CD3D
MBS7621821-01 0.01 mg

Recombinant Human CD3D

Sign In for Pricing
View Details
Recombinant Human CD3D
MBS7621821-02 0.05 mg

Recombinant Human CD3D

Sign In for Pricing
View Details
Recombinant Human CD3D
MBS7621821-03 0.5 mg

Recombinant Human CD3D

Sign In for Pricing
View Details
Recombinant Human CD3D
MBS7621821-04 1 mg

Recombinant Human CD3D

Sign In for Pricing
View Details