Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALMS1L (FITC)
554958-01 50 µg

ALMS1L (FITC)

Sign In for Pricing
View Details
ALMS1L (FITC)
554958-02 100 µg

ALMS1L (FITC)

Sign In for Pricing
View Details
Trp63 AAV siRNA Pooled Vector
48504164 1.0 µg

Trp63 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (MaxLight 750)
MBS6236850-01 0.1 mL

GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (MaxLight 750)

Sign In for Pricing
View Details
GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (MaxLight 750)
MBS6236850-02 5x 0.1 mL

GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (MaxLight 750)

Sign In for Pricing
View Details
LOC637599 Mouse siRNA Oligo Duplex (Locus ID 637599)
SR400142 1 Kit

LOC637599 Mouse siRNA Oligo Duplex (Locus ID 637599)

Sign In for Pricing
View Details