Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL10 antibody
70R-30832 100 ug

RPL10 antibody

Sign In for Pricing
View Details
RNU1-18P ORF Vector (Human) (pORF)
ORF029593 1.0 µg DNA

RNU1-18P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olfactory Receptor 10G6 discontinued
392470 200 µL

Olfactory Receptor 10G6 discontinued

Sign In for Pricing
View Details
Mouse Camk2n1 (NM_025451) AAV Particle
MR222090A1V 250 µL

Mouse Camk2n1 (NM_025451) AAV Particle

Sign In for Pricing
View Details
FANCE sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0756906 1.0 µg DNA

FANCE sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal HOP Antibody [DyLight 680]
NBP2-97809FR 0.1 mL

Rabbit Polyclonal HOP Antibody [DyLight 680]

Sign In for Pricing
View Details