Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf37 Over-expression Lysate Product
GWB-B00F90 0.1 mg

C3orf37 Over-expression Lysate Product

Sign In for Pricing
View Details
MIR6828 Human qPCR Template Standard (MI0022673)
HK301429 200 Reactions

MIR6828 Human qPCR Template Standard (MI0022673)

Sign In for Pricing
View Details
Phospho-MAPK8 (Thr183 + Tyr185) Polyclonal Antibody, Biotin Conjugated
bs-5487R-Biotin 100 µL

Phospho-MAPK8 (Thr183 + Tyr185) Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Rat Mep1a Pre-designed siRNA Set A
SI208320A 1 Each

Rat Mep1a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Surfactant Pulmonary Associated Protein D (SP-D), BioAssayTM ELISA Kit (Human)
353055 96 Tests

Surfactant Pulmonary Associated Protein D (SP-D), BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
PTP4A2 Antibody
F54431-0.08ML 0.08 mL

PTP4A2 Antibody

Sign In for Pricing
View Details