Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oleuropein
AB1098 20 mg

Oleuropein

Sign In for Pricing
View Details
SPNS2 (NM_001124758) Human Tagged ORF Clone
RC225940 10 µg

SPNS2 (NM_001124758) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse CD5L ELISA Kit
E047730 1 Each

Mouse CD5L ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TTK Protein - (Dry Ice)
P4790 100 µg

Recombinant Human TTK Protein - (Dry Ice)

Sign In for Pricing
View Details
Lentiviral human C10orf62 shRNA (UAS) - Lentiviral human C10orf62 shRNA (UAS) (25)
GTR15150029 1 Vial

Lentiviral human C10orf62 shRNA (UAS) - Lentiviral human C10orf62 shRNA (UAS) (25)

Sign In for Pricing
View Details
DUSP1 Mouse Monoclonal Antibody [Clone ID: OTI8A4]
CF812682 100 µg

DUSP1 Mouse Monoclonal Antibody [Clone ID: OTI8A4]

Sign In for Pricing
View Details