Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL15P3 siRNA Oligos set (Human)
40863171 3x 5 nmol

RPL15P3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal 4-1BB Ligand/TNFSF9 Antibody (2357A) [PE/Cy5.5]
FAB22952PECY55 0.1 mL

Rabbit Monoclonal 4-1BB Ligand/TNFSF9 Antibody (2357A) [PE/Cy5.5]

Sign In for Pricing
View Details
Costunolide
S1319-5mg 5 mg

Costunolide

Sign In for Pricing
View Details
VAC14 Protein Vector (Mouse) (pPB-C-His)
PV244802 500 ng

VAC14 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GPR155 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0898407 1.0 µg DNA

GPR155 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rat Eukaryotic peptide chain release factor GTP-binding subunit ERF3A, GSPT1 ELISA Kit
MBS7269520-01 48 Well

Rat Eukaryotic peptide chain release factor GTP-binding subunit ERF3A, GSPT1 ELISA Kit

Sign In for Pricing
View Details