Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USMG5 Adenovirus (Mouse)
49268054 1.0 mL

USMG5 Adenovirus (Mouse)

Sign In for Pricing
View Details
SYDE2 Human Gene Knockout Kit (CRISPR)
KN421270 1 Kit

SYDE2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Olr1720 Rat siRNA Oligo Duplex (Locus ID 406015)
SR509946 1 Kit

Olr1720 Rat siRNA Oligo Duplex (Locus ID 406015)

Sign In for Pricing
View Details
Tetraphenylarsonium (V) chloride
sc-253686A 10 g

Tetraphenylarsonium (V) chloride

Sign In for Pricing
View Details
Anti-CD137/Tnfrsf9 Antibody
MBS1751282-01 0.01 mg

Anti-CD137/Tnfrsf9 Antibody

Sign In for Pricing
View Details
Anti-CD137/Tnfrsf9 Antibody
MBS1751282-02 0.1 mg (Carrier Free)

Anti-CD137/Tnfrsf9 Antibody

Sign In for Pricing
View Details