Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

THLE-2 Cells
116294 1 Vial

THLE-2 Cells

Sign In for Pricing
View Details
RAB35, CT (RAB35, RAB1C, RAY, Ras-related protein Rab-35, GTP-binding protein RAY, Ras-related protein Rab-1C) (PE) discontinued
040760-PE 200 µL

RAB35, CT (RAB35, RAB1C, RAY, Ras-related protein Rab-35, GTP-binding protein RAY, Ras-related protein Rab-1C) (PE) discontinued

Sign In for Pricing
View Details
BIRC8 Protein Vector (Human) (pPM-C-HA)
PV004095 500 ng

BIRC8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Ndufa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3835205 3x 1.0 µg

Ndufa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
EPDR1 Rabbit Polyclonal Antibody
TA358356 100 µL

EPDR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR52L1 Antibody (C-term) [APR31404G]
APR31404G-01 50 µL

OR52L1 Antibody (C-term) [APR31404G]

Sign In for Pricing
View Details