Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexokinase 1 (HK1) (NM_000188) Human Over-expression Lysate
LH02794V 100 µg

Hexokinase 1 (HK1) (NM_000188) Human Over-expression Lysate

Sign In for Pricing
View Details
DDX55 (NM_020936) Human 3' UTR Clone
SC210090 10 µg

DDX55 (NM_020936) Human 3' UTR Clone

Sign In for Pricing
View Details
1-Decyl-3-methylimidazolium hexafluorophosphate
IL-0066-HP-0500 500 g

1-Decyl-3-methylimidazolium hexafluorophosphate

Sign In for Pricing
View Details
Rabbit Polyclonal IRAK4 Antibody
NBP2-99533-100ul 100 µL

Rabbit Polyclonal IRAK4 Antibody

Sign In for Pricing
View Details
Human SCNM1 qPCR Primer Pair
QH50961S 200 Tests

Human SCNM1 qPCR Primer Pair

Sign In for Pricing
View Details
Cdk2, Phosphorylated (Thr160) (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 750)
MBS6468498-01 0.1 mL

Cdk2, Phosphorylated (Thr160) (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 750)

Sign In for Pricing
View Details