Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD96 Antibody (BA072), FITC
MBS1584133-01 50 Tests

Anti-Human CD96 Antibody (BA072), FITC

Sign In for Pricing
View Details
Anti-Human CD96 Antibody (BA072), FITC
MBS1584133-02 100 Tests

Anti-Human CD96 Antibody (BA072), FITC

Sign In for Pricing
View Details
Anti-Human CD96 Antibody (BA072), FITC
MBS1584133-03 5x 100 Tests

Anti-Human CD96 Antibody (BA072), FITC

Sign In for Pricing
View Details
Rabbit Monoclonal CRABP2 Antibody (004) [mFluor Violet 610 SE]
NBP2-89836MFV610 0.1 mL

Rabbit Monoclonal CRABP2 Antibody (004) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Fgr sgRNA CRISPR Lentivector set (Rat)
K7030901 3x 1.0 µg

Fgr sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
E2F8 Peptide
DF6269-BP 1 mg

E2F8 Peptide

Sign In for Pricing
View Details