Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLECL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0464406 1.0 µg DNA

CLECL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human GUCA1A Protein, His & GST Tag
KMPH4577-01 20 µg

Human GUCA1A Protein, His & GST Tag

Sign In for Pricing
View Details
Human GUCA1A Protein, His & GST Tag
KMPH4577-02 100 µg

Human GUCA1A Protein, His & GST Tag

Sign In for Pricing
View Details
1,2,3,4-Tetrahydro-quinoline-3-carboxylic acid
sc-258919 100 mg

1,2,3,4-Tetrahydro-quinoline-3-carboxylic acid

Sign In for Pricing
View Details
Hsa-miR-514a-5p agomir
HY-R01549A-01 5 nmol

Hsa-miR-514a-5p agomir

Sign In for Pricing
View Details
Hsa-miR-514a-5p agomir
HY-R01549A-02 20 nmol

Hsa-miR-514a-5p agomir

Sign In for Pricing
View Details