Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC2 (Trafficking Protein Particle Complex Subunit 2, Sedlin, SEDL) (PE)
134692-PE 100 µL

TRAPPC2 (Trafficking Protein Particle Complex Subunit 2, Sedlin, SEDL) (PE)

Sign In for Pricing
View Details
Septin 3 Antibody
R35882-100UG 100 µg

Septin 3 Antibody

Sign In for Pricing
View Details
PAICS Recombinant Protein (Mouse)
RP159932 100 µg

PAICS Recombinant Protein (Mouse)

Sign In for Pricing
View Details
ZBTB16 3'UTR Luciferase Stable Cell Line
TU028725 1.0 mL

ZBTB16 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human soluble myosin heavy chain 1,sMHC-1 ELISA KIT
JOT-EK0177Hu 96 wells

Human soluble myosin heavy chain 1,sMHC-1 ELISA KIT

Sign In for Pricing
View Details
Smg9 Rat shRNA Lentiviral Particle (Locus ID 365215)
TL702359V 500 µL Each

Smg9 Rat shRNA Lentiviral Particle (Locus ID 365215)

Sign In for Pricing
View Details