Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Staphylococcus aureus Antibody (Biotin)
abx022234 1 mg

Staphylococcus aureus Antibody (Biotin)

Sign In for Pricing
View Details
ERVH48-1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV724408 1.0 µg DNA

ERVH48-1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ZCCHC12 (Zinc Finger CCHC Domain-containing Protein 12, Smad-interacting Zinc Finger Protein 1, SIZN1, SIZN, PNMA7A)
135526 50 µg

ZCCHC12 (Zinc Finger CCHC Domain-containing Protein 12, Smad-interacting Zinc Finger Protein 1, SIZN1, SIZN, PNMA7A)

Sign In for Pricing
View Details
Mouse Monoclonal CD79A Antibody (IGA/764) [Janelia Fluor 646]
NBP3-11494JF646 0.1 mL

Mouse Monoclonal CD79A Antibody (IGA/764) [Janelia Fluor 646]

Sign In for Pricing
View Details
Tissue Grinder Potter-Elvehjem, PTFE Pestle only, Sz 20 / 1 Pc.
1219877 1 PC

Tissue Grinder Potter-Elvehjem, PTFE Pestle only, Sz 20 / 1 Pc.

Sign In for Pricing
View Details
CHD1L, ID (CHD1L, ALC1, Chromodomain-helicase-DNA-binding protein 1-like, Amplified in liver cancer protein 1) (MaxLight 490) discontinued
033833-ML490 100 µL

CHD1L, ID (CHD1L, ALC1, Chromodomain-helicase-DNA-binding protein 1-like, Amplified in liver cancer protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details