Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chmp6 activation kit by CRISPRa
GA212841 1 Kit

Mouse Chmp6 activation kit by CRISPRa

Sign In for Pricing
View Details
Phos-PTEN Antibody (pS229)
F48735-0.4ML 0.4 mL

Phos-PTEN Antibody (pS229)

Sign In for Pricing
View Details
SSB (Lupus La Protein, La Autoantigen, La Ribonucleoprotein, Sjoegren Syndrome Type B Antigen, SS-B) (FITC)
MBS6149894-01 0.1 mL

SSB (Lupus La Protein, La Autoantigen, La Ribonucleoprotein, Sjoegren Syndrome Type B Antigen, SS-B) (FITC)

Sign In for Pricing
View Details
SSB (Lupus La Protein, La Autoantigen, La Ribonucleoprotein, Sjoegren Syndrome Type B Antigen, SS-B) (FITC)
MBS6149894-02 5x 0.1 mL

SSB (Lupus La Protein, La Autoantigen, La Ribonucleoprotein, Sjoegren Syndrome Type B Antigen, SS-B) (FITC)

Sign In for Pricing
View Details
Ripk3 (NM_019955) Mouse Tagged ORF Clone Lentiviral Particle
MR222511L4V 200 µL

Ripk3 (NM_019955) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TUSC3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
48848124 3x 1.0µg DNA

TUSC3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details