Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALX1 Antibody, HRP conjugated
A56021-50UG 50 µg

ALX1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Anti-ACVR2A & ACVR2B (Recombinant Human, Monoclonal, IgG1, lambda)
A133738 100 µL

Anti-ACVR2A & ACVR2B (Recombinant Human, Monoclonal, IgG1, lambda)

Sign In for Pricing
View Details
PGM3 Protein Vector (Mouse) (pPM-C-His)
PV215489 500 ng

PGM3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Xrcc2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6736906 1.0 µg DNA

Xrcc2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Platelet activating Factor (PAF) Porcine ELISA Kit
F9407 96 Tests

Platelet activating Factor (PAF) Porcine ELISA Kit

Sign In for Pricing
View Details
Mospd1 (NM_027409) Mouse Untagged Clone
MC211062 10 µg

Mospd1 (NM_027409) Mouse Untagged Clone

Sign In for Pricing
View Details