Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit
MBS700212-01 24 Well (LIMIT 1)

Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit

Sign In for Pricing
View Details
Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit
MBS700212-02 48 Well

Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit

Sign In for Pricing
View Details
Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit
MBS700212-03 96 Well

Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit

Sign In for Pricing
View Details
Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit
MBS700212-04 5x 96 Well

Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit

Sign In for Pricing
View Details
Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit
MBS700212-05 10x 96 Well

Human IL-1 Receptor Like 1, IL1RL1 ELISA Kit

Sign In for Pricing
View Details
JUN, ID (T93) (JUN, Transcription factor AP-1, Activator protein 1, Proto-oncogene c-Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39) (PE) discontinued
037222-PE 200 µL

JUN, ID (T93) (JUN, Transcription factor AP-1, Activator protein 1, Proto-oncogene c-Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39) (PE) discontinued

Sign In for Pricing
View Details