Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oncostatin M/OSM Recombinant Rabbit mAb
E43S48902 100 µL

Oncostatin M/OSM Recombinant Rabbit mAb

Sign In for Pricing
View Details
USP33 Human Recombinant Protein
TP725337 50 µg

USP33 Human Recombinant Protein

Sign In for Pricing
View Details
SPP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
45369121 3x 1.0µg DNA

SPP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human Cluster of Differentiation 109 ELISA Kit
MBS037548-01 48 Well

Human Cluster of Differentiation 109 ELISA Kit

Sign In for Pricing
View Details
Human Cluster of Differentiation 109 ELISA Kit
MBS037548-02 96 Well

Human Cluster of Differentiation 109 ELISA Kit

Sign In for Pricing
View Details
Human Cluster of Differentiation 109 ELISA Kit
MBS037548-03 5x 96 Well

Human Cluster of Differentiation 109 ELISA Kit

Sign In for Pricing
View Details