Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Atf7ip2 ELISA KIT
ELI-39146m 96 Tests

Mouse Atf7ip2 ELISA KIT

Sign In for Pricing
View Details
Cytochrome P450 26B1 Antibody
E38PA7488 100 µL

Cytochrome P450 26B1 Antibody

Sign In for Pricing
View Details
Lentiviral human LLCFC1 sgRNA gene knockout kit - Lentiviral human LLCFC1 sgRNA gene knockout kit (plasmid)
GTR15389384 1 Vial

Lentiviral human LLCFC1 sgRNA gene knockout kit - Lentiviral human LLCFC1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human LILRB4 shRNA Plasmid
abx957516-01 150 µg

Human LILRB4 shRNA Plasmid

Sign In for Pricing
View Details
Human LILRB4 shRNA Plasmid
abx957516-02 300 µg

Human LILRB4 shRNA Plasmid

Sign In for Pricing
View Details
ADH1B (NM_000668) Human Tagged ORF Clone Lentiviral Particle
RC205391L4V 200 µL

ADH1B (NM_000668) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details