Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RAGE-1/MOK Protein, N-His-SUMO
E55P5948 50 µg

Recombinant Human RAGE-1/MOK Protein, N-His-SUMO

Sign In for Pricing
View Details
Mouse Monoclonal ABCG2/CD338 Antibody (3G8) [Alexa Fluor 488]
NBP2-22124AF488 0.1 mL

Mouse Monoclonal ABCG2/CD338 Antibody (3G8) [Alexa Fluor 488]

Sign In for Pricing
View Details
MMS2 (UBE2V2) Rabbit Polyclonal Antibody
TA383031 100 µL

MMS2 (UBE2V2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APOC2, ID (Apolipoprotein C-II, Apo-CII, ApoC-II, APC2) (APC)
MBS6463721-01 0.2 mL

APOC2, ID (Apolipoprotein C-II, Apo-CII, ApoC-II, APC2) (APC)

Sign In for Pricing
View Details
APOC2, ID (Apolipoprotein C-II, Apo-CII, ApoC-II, APC2) (APC)
MBS6463721-02 5x 0.2 mL

APOC2, ID (Apolipoprotein C-II, Apo-CII, ApoC-II, APC2) (APC)

Sign In for Pricing
View Details
STEAP3, CT (STEAP3, TSAP6, Metalloreductase STEAP3, Dudulin-2, Six-transmembrane epithelial antigen of prostate 3, Tumor suppressor-activated pathway protein 6, pHyde) (Azide free) (HRP)
MBS6351943-01 0.2 mL

STEAP3, CT (STEAP3, TSAP6, Metalloreductase STEAP3, Dudulin-2, Six-transmembrane epithelial antigen of prostate 3, Tumor suppressor-activated pathway protein 6, pHyde) (Azide free) (HRP)

Sign In for Pricing
View Details