Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Human (His)

IFN-lambda 2/IL-28A protein is a multifunctional cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in antiviral host defense, particularly within epithelial tissues. Animal-Free IFN-lambda 2/IL-28A Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-human-his.html

Purity

95.00

Smiles

MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Formula

282616 (Gene_ID) Q8IZJ0 (P27-V200) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYP-AS1 Adenovirus (Human)
45987051 1.0 mL

SYP-AS1 Adenovirus (Human)

Sign In for Pricing
View Details
TRIM43A Adenovirus (Rat)
47787056 1.0 mL

TRIM43A Adenovirus (Rat)

Sign In for Pricing
View Details
Olfactory receptor 52N1 Polyclonal Antibody
BT-AP06489-01 20 µL

Olfactory receptor 52N1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 52N1 Polyclonal Antibody
BT-AP06489-02 50 µL

Olfactory receptor 52N1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 52N1 Polyclonal Antibody
BT-AP06489-03 100 µL

Olfactory receptor 52N1 Polyclonal Antibody

Sign In for Pricing
View Details
ZFYVE9 (Zinc Finger, FYVE Domain Containing 9, MADHIP, NSP, SARA, SMADIP) (MaxLight 490)
MBS6451845-01 0.1 mL

ZFYVE9 (Zinc Finger, FYVE Domain Containing 9, MADHIP, NSP, SARA, SMADIP) (MaxLight 490)

Sign In for Pricing
View Details