Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAGA, Human (HEK293, His)

NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NAGA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/naga-protein-human-hek293-his.html

Purity

97.00

Smiles

LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ

Molecular Formula

4668 (Gene_ID) P17050 (L18-Q411) (Accession)

Molecular Weight

Approximately 47-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-APOE (human) -shRNA2-Puro
BZ56671 1 Vial

PLV3-U6-APOE (human) -shRNA2-Puro

Sign In for Pricing
View Details
GZMK Conjugated Antibody
C40180 100 µL

GZMK Conjugated Antibody

Sign In for Pricing
View Details
SNX24 Antibody (Biotin)
orb356888-01 50 µg

SNX24 Antibody (Biotin)

Sign In for Pricing
View Details
SNX24 Antibody (Biotin)
orb356888-02 100 µg

SNX24 Antibody (Biotin)

Sign In for Pricing
View Details
Defb8 Protein Vector (Mouse) (pPM-C-His)
PV171605 500 ng

Defb8 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Fibroblast Growth Factor 21 (FGF21) Polyclonal Antibody
CAU31605-01 100 µL

Fibroblast Growth Factor 21 (FGF21) Polyclonal Antibody

Sign In for Pricing
View Details