Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METAP1D/Methionine aminopeptidase 1D, Human (His)

METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val) . METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

METAP1D/Methionine aminopeptidase 1D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/metap1d-protein-human-his.html

Purity

96

Smiles

RQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA

Molecular Formula

254042 (Gene_ID) Q6UB28 (R44-A335) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti-GST-tag Antibody
DL95395A-01 50 µL

Mouse anti-GST-tag Antibody

Sign In for Pricing
View Details
Mouse anti-GST-tag Antibody
DL95395A-02 100 µL

Mouse anti-GST-tag Antibody

Sign In for Pricing
View Details
Pristane
GK4808-250ml 250 mL

Pristane

Sign In for Pricing
View Details
LTV1 antibody - C-terminal region
MBS3216587-01 0.1 mL

LTV1 antibody - C-terminal region

Sign In for Pricing
View Details
LTV1 antibody - C-terminal region
MBS3216587-02 5x 0.1 mL

LTV1 antibody - C-terminal region

Sign In for Pricing
View Details
ING2 Recombinant Protein Antigen
NBP3-05514PEP 100 µL

ING2 Recombinant Protein Antigen

Sign In for Pricing
View Details