Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acyl-CoA-binding protein (Dbi)

Product Specifications

Product Name Alternative

(ACBP) (Diazepam-binding inhibitor) (DBI) (Endozepine) (EP)

Abbreviation

Recombinant Mouse Dbi protein

Gene Name

Dbi

UniProt

P31786

Expression Region

2-87aa

Organism

Mus musculus (Mouse)

Target Sequence

SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Metabolism

Relevance

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.9 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il17a Rat Monoclonal Antibody [Clone ID: 20B4.G10.F5]
TA397268S 25 µL

Il17a Rat Monoclonal Antibody [Clone ID: 20B4.G10.F5]

Sign In for Pricing
View Details
Human NAP1 (NAA25) activation kit by CRISPRa
GA112792 1 Kit

Human NAP1 (NAA25) activation kit by CRISPRa

Sign In for Pricing
View Details
Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR1A10]
TA592984 100 µL

Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR1A10]

Sign In for Pricing
View Details
CD38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B2]
TA810515BM 100 µL

CD38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B2]

Sign In for Pricing
View Details
ADK Stab NA 21E
TRC-A291810-1G 1 g

ADK Stab NA 21E

Sign In for Pricing
View Details
ATP11A Human Gene Knockout Kit (CRISPR)
KN423785 1 Kit

ATP11A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details