Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Mouse (CHO)

IL-12 Protein, Mouse (CHO) has both T cell growth and IFN-γ stimulatory properties.

Product Specifications

Product Name Alternative

IL-12 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-protein-mouse-cho.html

Purity

95.00

Smiles

P35:RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAp40:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Formula

16159&16160 (Gene_ID) P43431 (R23-A215) &P43432 (M23-S335) (Accession)

Molecular Weight

Approximately 24-29 kDa (p35) &42-53 kDa (p40), due to the glycosylation.

References & Citations

[1]Hsieh CS, et al. Development of TH1 CD4+ T cells through IL-12 produced by Listeria-induced macrophages. Science. 1993 Apr 23;260 (5107) :547-9.|[2]Heinzel FP, et al. Recombinant interleukin 12 cures mice infected with Leishmania major. J Exp Med. 1993 May 1;177 (5) :1505-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zfp800 qPCR Primer Pair
QM76322S 200 Tests

Mouse Zfp800 qPCR Primer Pair

Sign In for Pricing
View Details
EVPL ELISA Kit (Human) (OKCD00335)
OKCD00335 96 Well

EVPL ELISA Kit (Human) (OKCD00335)

Sign In for Pricing
View Details
SLC38A4 3'UTR Lenti-reporter-Luc Vector
44171081 1.0 µg

SLC38A4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse PHF8 siRNA
abx928459-01 15 nmol

Mouse PHF8 siRNA

Sign In for Pricing
View Details
Mouse PHF8 siRNA
abx928459-02 30 nmol

Mouse PHF8 siRNA

Sign In for Pricing
View Details
P40 (Rabbit PAb), CF740 conjugate, 0.1mg/mL
BNC740375-500 1x 500 µL

P40 (Rabbit PAb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details