Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Mouse (CHO)

IL-12 Protein, Mouse (CHO) has both T cell growth and IFN-γ stimulatory properties.

Product Specifications

Product Name Alternative

IL-12 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-protein-mouse-cho.html

Purity

95.00

Smiles

P35:RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAp40:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Formula

16159&16160 (Gene_ID) P43431 (R23-A215) &P43432 (M23-S335) (Accession)

Molecular Weight

Approximately 24-29 kDa (p35) &42-53 kDa (p40), due to the glycosylation.

References & Citations

[1]Hsieh CS, et al. Development of TH1 CD4+ T cells through IL-12 produced by Listeria-induced macrophages. Science. 1993 Apr 23;260 (5107) :547-9.|[2]Heinzel FP, et al. Recombinant interleukin 12 cures mice infected with Leishmania major. J Exp Med. 1993 May 1;177 (5) :1505-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Oxct2b shRNA (UAS) - Lentiviral mouse Oxct2b shRNA (UAS, RFP) (25)
GTR15195347 1 Vial

Lentiviral mouse Oxct2b shRNA (UAS) - Lentiviral mouse Oxct2b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Olfactory receptor 2J3 Polyclonal Antibody
JOT-AP06416-01 20 µL

Olfactory receptor 2J3 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 2J3 Polyclonal Antibody
JOT-AP06416-02 50 μL

Olfactory receptor 2J3 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 2J3 Polyclonal Antibody
JOT-AP06416-03 100 µL

Olfactory receptor 2J3 Polyclonal Antibody

Sign In for Pricing
View Details
PITX3 Rabbit Polyclonal Antibody (Cy7)
orb1045793 100 µL

PITX3 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
1-Methyl-1-propylpiperidinium bromide
IL-0090-HP-0050 50 g

1-Methyl-1-propylpiperidinium bromide

Sign In for Pricing
View Details