Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Mouse (CHO)

IL-12 Protein, Mouse (CHO) has both T cell growth and IFN-γ stimulatory properties.

Product Specifications

Product Name Alternative

IL-12 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-protein-mouse-cho.html

Purity

95.00

Smiles

P35:RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAp40:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Formula

16159&16160 (Gene_ID) P43431 (R23-A215) &P43432 (M23-S335) (Accession)

Molecular Weight

Approximately 24-29 kDa (p35) &42-53 kDa (p40), due to the glycosylation.

References & Citations

[1]Hsieh CS, et al. Development of TH1 CD4+ T cells through IL-12 produced by Listeria-induced macrophages. Science. 1993 Apr 23;260 (5107) :547-9.|[2]Heinzel FP, et al. Recombinant interleukin 12 cures mice infected with Leishmania major. J Exp Med. 1993 May 1;177 (5) :1505-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Myoglobin (MYO)
TRV-0036073-01 20 µL

Polyclonal Antibody to Myoglobin (MYO)

Sign In for Pricing
View Details
Polyclonal Antibody to Myoglobin (MYO)
TRV-0036073-02 100 µL

Polyclonal Antibody to Myoglobin (MYO)

Sign In for Pricing
View Details
Polyclonal Antibody to Myoglobin (MYO)
TRV-0036073-03 200 µL

Polyclonal Antibody to Myoglobin (MYO)

Sign In for Pricing
View Details
Polyclonal Antibody to Myoglobin (MYO)
TRV-0036073-04 1 mL

Polyclonal Antibody to Myoglobin (MYO)

Sign In for Pricing
View Details
Mouse Core histone macro-H2A.2 (H2AFY2) ELISA Kit
MBS7235035-01 48 Well

Mouse Core histone macro-H2A.2 (H2AFY2) ELISA Kit

Sign In for Pricing
View Details
Mouse Core histone macro-H2A.2 (H2AFY2) ELISA Kit
MBS7235035-02 96 Well

Mouse Core histone macro-H2A.2 (H2AFY2) ELISA Kit

Sign In for Pricing
View Details