Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Nuclear export protein (NS)

Product Specifications

Product Name Alternative

Non-structural protein 2 (NS2) (NEP)

Abbreviation

Recombinant Influenza B virus Nuclear export protein

Gene Name

NS

UniProt

P08014

Expression Region

1-122aa

Organism

Influenza B virus (strain B/Yamagata/1/1973)

Target Sequence

MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Mediates the nuclear export of encapsidated genomic RNAs. Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.8 kDa

References & Citations

"Influenza B and C virus NEP (NS2) proteins possess nuclear export activities." Paragas J., Talon J., O'Neill R.E., Anderson D.K., Garcia-Sastre A., Palese P. J. Virol. 75:7375-7383 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse OX40 Protein, hFc Tag
orb1290898-01 10 µg

Mouse OX40 Protein, hFc Tag

Sign In for Pricing
View Details
Mouse OX40 Protein, hFc Tag
orb1290898-02 50 µg

Mouse OX40 Protein, hFc Tag

Sign In for Pricing
View Details
Mouse OX40 Protein, hFc Tag
orb1290898-03 100 µg

Mouse OX40 Protein, hFc Tag

Sign In for Pricing
View Details
Hsa-miR-3622a-5p miRNA Agomir
CMJ1113-01 5 nmol

Hsa-miR-3622a-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3622a-5p miRNA Agomir
CMJ1113-02 10 nmol

Hsa-miR-3622a-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3622a-5p miRNA Agomir
CMJ1113-03 20 nmol

Hsa-miR-3622a-5p miRNA Agomir

Sign In for Pricing
View Details