Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Mouse (HEK293, His)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, His) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GM-CSF Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Molecular Formula

12981 (Gene_ID) P01587 (A18-K141) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Drosha Mouse Gene Knockout Kit (CRISPR)
KN304817LP 1 Kit

Drosha Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL
BNC882316-500 1x 500 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C11orf20 (TEX40) (NM_001039496) Human Over-expression Lysate
LY422061 100 µg

C11orf20 (TEX40) (NM_001039496) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Bromo-1-(3,5-dihydroxyphenyl)ethanone
TRC-B684050-5G 5 g

2-Bromo-1-(3,5-dihydroxyphenyl)ethanone

Sign In for Pricing
View Details
NAPRT1 (NAPRT) (NM_145201) Human Over-expression Lysate
LC403430 20 µg

NAPRT1 (NAPRT) (NM_145201) Human Over-expression Lysate

Sign In for Pricing
View Details
RPP30 Human Gene Knockout Kit (CRISPR)
KN402686 1 Kit

RPP30 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details