Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Mouse (HEK293, His)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, His) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GM-CSF Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Molecular Formula

12981 (Gene_ID) P01587 (A18-K141) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP29 Rabbit Polyclonal Antibody
ER1902-76 100 µL

USP29 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MlN4924
SIH-331-200UG 200 µg

MlN4924

Sign In for Pricing
View Details
HSD3B7 Human Gene Knockout Kit (CRISPR)
KN402468 1 Kit

HSD3B7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns
QLMM07 150 Reactions

ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns

Sign In for Pricing
View Details
HOXD13 (Center) Rabbit Polyclonal Antibody
AP52087PU-N 400 µL

HOXD13 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
mCherry Mouse Monoclonal Antibody [A9F2]
HA601186 100 µL

mCherry Mouse Monoclonal Antibody [A9F2]

Sign In for Pricing
View Details