GM-CSF, Mouse (HEK293, His)
The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, His) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
GM-CSF Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse-hek-293-his.html
Purity
95.00
Smiles
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Molecular Formula
12981 (Gene_ID) P01587 (A18-K141) (Accession)
Molecular Weight
Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Eph receptor A4 (EPHA4) Human shRNA Plasmid Kit (Locus ID 2043)
Prealbumin (TTR) (NM_000371) Human Recombinant Protein
![Rabbit Polyclonal MFSD11 Antibody [PE]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
Kip2, p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) (MaxLight 405) discontinued
DCN, ID (DCN, Bone Proteoglycan II, CSCD, DSPG2, PG40, PGII, PGS2, Small Leucine Rich Protein 1B, SLRR1B) (MaxLight 405) discontinued