OSM, Human (209a.a)
OSM Protein, Human (209a.a) is a polypeptide chain containing 209 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.
Product Specifications
Product Name Alternative
OSM Protein, Human (209a.a), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Applications
Neuroscience-Neuromodulation
Assay Protocol
https://www.medchemexpress.com/cytokines/osm-protein-human-209a-a.html
Purity
96.00
Smiles
MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
Molecular Formula
5008 (Gene_ID) P13725 (A26-R234) (Accession)
Molecular Weight
Approximately 24-26 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Hermanns HM, et al. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :545-58.|[2]Gómez-Lechón MJ, et al. Oncostatin M: signal transduction and biological activity. Life Sci. 1999;65 (20) :2019-30.|[3]Chen SH, et al. Oncostatin M: a pleiotropic cytokine in the central nervous system. Cytokine Growth Factor Rev. 2004 Oct;15 (5) :379-91.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM3227-50 1x 50 µL
Prohibitin (Mitochondrial Marker) (PHB/3227), 1mg/mL
Sign In for Pricing
View Details 
![TCF12 Mouse Monoclonal Antibody [Clone ID: OTI4A1]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9086a1/imageurl/cf809705.webp)
BNC471481-100 1x 100 µL
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041036-100 1x 100 µL
CD41a (ITGA2B/1036), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 