Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (209a.a)

OSM Protein, Human (209a.a) is a polypeptide chain containing 209 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.

Product Specifications

Product Name Alternative

OSM Protein, Human (209a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-209a-a.html

Purity

96.00

Smiles

MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R234) (Accession)

Molecular Weight

Approximately 24-26 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hermanns HM, et al. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :545-58.|[2]Gómez-Lechón MJ, et al. Oncostatin M: signal transduction and biological activity. Life Sci. 1999;65 (20) :2019-30.|[3]Chen SH, et al. Oncostatin M: a pleiotropic cytokine in the central nervous system. Cytokine Growth Factor Rev. 2004 Oct;15 (5) :379-91.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR2J Protein Vector (Rat) (pPB-N-His)
PV295159 500 ng

POLR2J Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
TRAF5 Antibody
DF12779-01 100 µL

TRAF5 Antibody

Sign In for Pricing
View Details
TRAF5 Antibody
DF12779-02 200 µL

TRAF5 Antibody

Sign In for Pricing
View Details
Boc-Lys(Boc)-Pro-OH
A-1035.0005 5.0g

Boc-Lys(Boc)-Pro-OH

Sign In for Pricing
View Details
Fmoc-(S)-3-Amino-3-(4-nitro-phenyl)-propionic acid
MBS9024436-01 1 g

Fmoc-(S)-3-Amino-3-(4-nitro-phenyl)-propionic acid

Sign In for Pricing
View Details
Fmoc-(S)-3-Amino-3-(4-nitro-phenyl)-propionic acid
MBS9024436-02 5x 1 g

Fmoc-(S)-3-Amino-3-(4-nitro-phenyl)-propionic acid

Sign In for Pricing
View Details