Recombinant Rat Chemerin-like receptor 2 (Cmklr2)

MEVSREMLFEELDNYSYALEYYSQEPDAEENVYPGIVHWISLLLYALAFVLGIPGNAIVIWFMGFKWKKTVTTLWFLNLAIADFVFVLFLPLYISYVALSFHWPFGRWLCKLNSFIAQLNMFSSVFFLTVISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLLGGPTLYFRDTVEVNNRIICYNNFQEYELTLMRHHVLTWVKFLFGYLLPLLTMSSCYLCLIFKTKKQNILISSKHLWMILSVVIAFMVCWTPFHLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPILYVLISKKFQARFRASVAEVLKRSLWEASCSGTVSEQLRSAETKSLSLLETAQ

Receptor for chemoattractant adipokine chemerin/RARRES2 suggesting a role for this receptor in the regulation of inflammation and energy homesotasis . Signals mainly via beta-arrestin pathway. Binding of RARRES2 activates weakly G proteins, calcium mobilization and MAPK1/MAPK3 (ERK1/2) phosphorylation too. Acts also as a receptor for TAFA1, mediates its effects on neuronal stem-cell proliferation and differentiation via the activation of ROCK/ERK and ROCK/STAT3 signaling pathway .

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

"Mapping studies of two G protein-coupled receptor genes: an amino acid difference may confer a functional variation between a human and rodent receptor." Marchese A., Cheng R., Lee M.C., Porter C.A., Heiber M., Goodman M., George S.R., O'Dowd B.F. Biochem. Biophys. Res. Commun. 205:1952-1958 (1994)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.