IGFL2, Human (HEK293, N-hFc)
The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, N-hFc) is the recombinant human-derived IGFL2, expressed by HEK293, with N-hFc labeled tag. The total length of IGFL2 Protein, Human (HEK293, N-hFc) is 94 a.a..
Product Specifications
Product Name Alternative
IGFL2 Protein, Human (HEK293, N-hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igfl2-protein-human-hek293-n-hfc.html
Purity
96.70
Smiles
PAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
Molecular Formula
147920 (Gene_ID) Q6UWQ7-1 (P26-P119) (Accession)
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF488A conjugate, 0.1mg/mL
CD8 (C8/468 + C8/144B), CF488A conjugate, 0.1mg/mL
