Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL2, Human (HEK293, N-hFc)

The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, N-hFc) is the recombinant human-derived IGFL2, expressed by HEK293, with N-hFc labeled tag. The total length of IGFL2 Protein, Human (HEK293, N-hFc) is 94 a.a..

Product Specifications

Product Name Alternative

IGFL2 Protein, Human (HEK293, N-hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfl2-protein-human-hek293-n-hfc.html

Purity

96.70

Smiles

PAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP

Molecular Formula

147920 (Gene_ID) Q6UWQ7-1 (P26-P119) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α- (Aminomethyl) -6-fluoro-3,4-dihydro-2H-1-benzopyran-2-methanol (Mixture of Diastereomers)
002357 25 mg

α- (Aminomethyl) -6-fluoro-3,4-dihydro-2H-1-benzopyran-2-methanol (Mixture of Diastereomers)

Sign In for Pricing
View Details
STNL F003-150x50-PP-CRD/1 AC Signs
817254 Card of 1 Pictogram(s)

STNL F003-150x50-PP-CRD/1 AC Signs

Sign In for Pricing
View Details
Rat Secretory Immunoglobulin A ELISA Kit
IRTSIGAKT 1 Each

Rat Secretory Immunoglobulin A ELISA Kit

Sign In for Pricing
View Details
Mussaenosidic acid
orb1992435 2 mg

Mussaenosidic acid

Sign In for Pricing
View Details
hsa-miR-224-3p miRNA Mimic
MCH01596 2x 2.5 nmol

hsa-miR-224-3p miRNA Mimic

Sign In for Pricing
View Details
CYP7B1 discontinued
535342-01 30ul

CYP7B1 discontinued

Sign In for Pricing
View Details