Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse-tag-free.html

Purity

95.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742 (M1-L164) (Accession)

Molecular Weight

Approximately 18.07 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smarcd3 Mouse Gene Knockout Kit (CRISPR)
KN516292 1 Kit

Smarcd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,4-Dihydro-[1,2,4]triazole-3-thione
TRC-D679075-500MG 500 mg

2,4-Dihydro-[1,2,4]triazole-3-thione

Sign In for Pricing
View Details
MKLP1 Recombinant Rabbit Monoclonal Antibody [SY02-74]
ET1607-63 100 µL

MKLP1 Recombinant Rabbit Monoclonal Antibody [SY02-74]

Sign In for Pricing
View Details
sn-Glycerol 3-Phosphate Bis(cyclohexylammonium) Salt
TRC-G601590-1G 1 g

sn-Glycerol 3-Phosphate Bis(cyclohexylammonium) Salt

Sign In for Pricing
View Details
ASPA (NM_001128085) Human Recombinant Protein
TP325443 20 µg

ASPA (NM_001128085) Human Recombinant Protein

Sign In for Pricing
View Details
FXR1 (NM_001013438) Human Recombinant Protein
TP762611 50 µg

FXR1 (NM_001013438) Human Recombinant Protein

Sign In for Pricing
View Details