Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse-tag-free.html

Purity

95.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742 (M1-L164) (Accession)

Molecular Weight

Approximately 18.07 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF671 Pre-designed siRNA Set A
SI018991A 1 Each

Human ZNF671 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TIMP2 Antibody
orb652622 100 µL

TIMP2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IL18R1 Antibody (B-E43) [Alexa Fluor 488]
NBP3-14586AF488 0.1 mL

Mouse Monoclonal IL18R1 Antibody (B-E43) [Alexa Fluor 488]

Sign In for Pricing
View Details
SDF2 Rabbit Polyclonal Antibody
orb580498 100 µL

SDF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPR 3'UTR GFP Stable Cell Line
TU074524 1.0 mL

SPR 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phospho-4E-BP1 (Thr36) Peptide
AF3431-BP 1 mg

Phospho-4E-BP1 (Thr36) Peptide

Sign In for Pricing
View Details