Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein cereblon (CRBN), partial

Product Specifications

Abbreviation

Recombinant Human CRBN protein, partial

Gene Name

CRBN

UniProt

Q96SW2

Expression Region

318-426aa

Organism

Homo sapiens (Human)

Target Sequence

CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.1 kDa

References & Citations

Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.Whitaker G.M., Lynn F.C., McIntosh C.H., Accili E.A.PLoS ONE 7:E32675-E32675 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Spinal cord
CS805920 5x 5 µm

Tissue FFPE Sections, Spinal cord

Sign In for Pricing
View Details
SHARP2 (BHLHE40) Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF810130 100 µg

SHARP2 (BHLHE40) Mouse Monoclonal Antibody [Clone ID: OTI2C9]

Sign In for Pricing
View Details
Human ADAM28 activation kit by CRISPRa
GA107438 1 Kit

Human ADAM28 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS648945 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Cell Meter™ Live Cell TUNEL Apoptosis Assay Kit *Red Fluorescence*
22844-AAT 50 Tests

Cell Meter™ Live Cell TUNEL Apoptosis Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
Art4 Mouse Gene Knockout Kit (CRISPR)
KN501633 1 Kit

Art4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details