Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein cereblon (CRBN), partial

Product Specifications

Abbreviation

Recombinant Human CRBN protein, partial

Gene Name

CRBN

UniProt

Q96SW2

Expression Region

318-426aa

Organism

Homo sapiens (Human)

Target Sequence

CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.1 kDa

References & Citations

Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.Whitaker G.M., Lynn F.C., McIntosh C.H., Accili E.A.PLoS ONE 7:E32675-E32675 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A38 Recombinant Rabbit Monoclonal Antibody [PSH02-79]
HA721857 100 µL

SLC25A38 Recombinant Rabbit Monoclonal Antibody [PSH02-79]

Sign In for Pricing
View Details
CC2D2B Human qPCR Primer Pair (NM_001130446)
HP232197 200 Reactions

CC2D2B Human qPCR Primer Pair (NM_001130446)

Sign In for Pricing
View Details
Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G5]
TA500598AM 100 µL

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G5]

Sign In for Pricing
View Details
Recombinant PKC alpha Antibody
RC-7045-01 50 μL

Recombinant PKC alpha Antibody

Sign In for Pricing
View Details
Recombinant PKC alpha Antibody
RC-7045-02 100 µL

Recombinant PKC alpha Antibody

Sign In for Pricing
View Details
Recombinant PKC alpha Antibody
RC-7045-03 1 mL

Recombinant PKC alpha Antibody

Sign In for Pricing
View Details