Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB2, Human (His)

HSPB2 Protein potentially regulates the kinase DMPK, enhancing its activity and influencing cellular processes. The specific mechanisms and broader implications in cellular signaling pathways require elucidation. Comprehensive studies are essential to unravel the precise molecular pathways and functional significance of the HSPB2-DMPK interplay, shedding light on its potential contributions to cellular regulation and signaling cascades. HSPB2 Protein, Human (His) is the recombinant human-derived HSPB2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HSPB2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hspb2-protein-human-his.html

Smiles

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Molecular Formula

3316 (Gene_ID) Q16082 (M1-P182) (Accession)

Molecular Weight

Approximately 22-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal TRIAD3 Antibody
NBP3-29436 100 µg

Rabbit Polyclonal TRIAD3 Antibody

Ask
View Details
Rabbit Monoclonal COP1 Antibody
NBP3-33502-20ul 20 µL

Rabbit Monoclonal COP1 Antibody

Ask
View Details
BAFF Rabbit Monoclonal Antibody
AMRe87494-01 1 Each

BAFF Rabbit Monoclonal Antibody

Ask
View Details
BAFF Rabbit Monoclonal Antibody
AMRe87494-02 50 µL

BAFF Rabbit Monoclonal Antibody

Ask
View Details
BAFF Rabbit Monoclonal Antibody
AMRe87494-03 100 µL

BAFF Rabbit Monoclonal Antibody

Ask
View Details
GPR120-IN-1 10mg
A20328-10 10 mg

GPR120-IN-1 10mg

Ask
View Details