Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NHP2, Human (His)

The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NHP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nhp2-protein-human-his.html

Smiles

MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL

Molecular Formula

55651 (Gene_ID) Q9NX24 (M1-L153) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal FLIP Antibody
AMM04553G 0.1 mg

Polyclonal FLIP Antibody

Sign In for Pricing
View Details
Usp45 3'UTR Luciferase Stable Cell Line
TU222950 1.0 mL

Usp45 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Il12a (NM_008351) Mouse Tagged Lenti ORF Clone
MR225608L3 10 µg

Il12a (NM_008351) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal VPS41 Antibody
NBP2-88582 100 µL

Rabbit Polyclonal VPS41 Antibody

Sign In for Pricing
View Details
TANK / ITRAF (Isoform "Short" ) (1-119) Human Protein
AR09179PU-L 500 µg

TANK / ITRAF (Isoform "Short" ) (1-119) Human Protein

Sign In for Pricing
View Details
GFP hsa-miR-6755-5p AAV miRNA Vector
Amh1238400 500 ng

GFP hsa-miR-6755-5p AAV miRNA Vector

Sign In for Pricing
View Details