Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutathione peroxidase 3 (GPX3)

Product Specifications

CAS Number

9000-83-3

Gene Name

GPX3

UniProt

P22352

Expression Region

21-226aa (U73C)

Organism

Homo sapiens

Target Sequence

QSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK

Tag

C-terminal 6xHis-tagged

Source

E.coli

Field of Research

Cancer

Assay Type

Developed Protein

Relevance

Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Oxnad1 Pre-designed siRNA Set B
SI109995B 1 Each

Mouse Oxnad1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Monoclonal GATA-3 Antibody (rGATA3/9107) [HRP]
NBP3-24294H 0.1 mL

Rabbit Monoclonal GATA-3 Antibody (rGATA3/9107) [HRP]

Sign In for Pricing
View Details
FYN antibody
10R-10608 100 ug

FYN antibody

Sign In for Pricing
View Details
TRA16 antibody
MBS5301531-01 0.1 mL

TRA16 antibody

Sign In for Pricing
View Details
TRA16 antibody
MBS5301531-02 5x 0.1 mL

TRA16 antibody

Sign In for Pricing
View Details
Human LMAN1L qPCR Primer Pair
QH52097S 200 Tests

Human LMAN1L qPCR Primer Pair

Sign In for Pricing
View Details