CD81, Human (His-SUMO)
The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (His-SUMO) is the recombinant human-derived CD81 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
CD81 Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd81-protein-human-his-sumo.html
Smiles
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular Formula
975 (Gene_ID) P60033 (F113-K201) (Accession)
Molecular Weight
Approximately 25.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Aurora B (Proliferation Marker) (AURKB/1593), CF740 conjugate, 0.1mg/mL
