Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Human (His-SUMO)

The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (His-SUMO) is the recombinant human-derived CD81 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-human-his-sumo.html

Smiles

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Molecular Formula

975 (Gene_ID) P60033 (F113-K201) (Accession)

Molecular Weight

Approximately 25.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR560205 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
IDNK (NM_001001551) Human Over-expression Lysate
LY424376 100 µg

IDNK (NM_001001551) Human Over-expression Lysate

Sign In for Pricing
View Details
NTH1 (NTHL1) (Center) Rabbit Polyclonal Antibody
AP52951PU-N 400 µL

NTH1 (NTHL1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCR8 (C-term) Rabbit Polyclonal Antibody
AP50827PU-N 400 µL

CCR8 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Orexin (OX) ELISA Kit
RD-OX-Hu-01 96 Tests

Human Orexin (OX) ELISA Kit

Sign In for Pricing
View Details
Human Orexin (OX) ELISA Kit
RD-OX-Hu-02 48 Tests

Human Orexin (OX) ELISA Kit

Sign In for Pricing
View Details