Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EpCAM/TROP1, Human (HEK293, His)

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. EpCAM/TROP1 Protein, Human (HEK293, His) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EpCAM/TROP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epcam-trop1-protein-human-hek-293-his.html

Purity

95.0

Smiles

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Molecular Formula

4072 (Gene_ID) AAH14785.1 (Q24-K265) (Accession)

Molecular Weight

Approximately 34-42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tauro-β-muricholic Acid (sodium salt)
C8637-10 10 mg

Tauro-β-muricholic Acid (sodium salt)

Sign In for Pricing
View Details
PBX1 Protein Vector (Human) (pPB-N-His)
PV109779 500 ng

PBX1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
KIAA1199 (Protein KIAA1199, TMEM2L, CCSP1, IR2155535) (APC)
128796-APC 100 µL

KIAA1199 (Protein KIAA1199, TMEM2L, CCSP1, IR2155535) (APC)

Sign In for Pricing
View Details
ARHGAP22 Rabbit Polyclonal Antibody
orb1175203 100 µg

ARHGAP22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trmt112 (NM_001166370) Mouse Tagged Lenti ORF Clone
MR219242L4 10 µg

Trmt112 (NM_001166370) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus UPF0175 protein AF_0100 (AF_0100)
MBS1164033-01 0.02 mg (E-Coli)

Recombinant Archaeoglobus fulgidus UPF0175 protein AF_0100 (AF_0100)

Sign In for Pricing
View Details