Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFPT1, Human

As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GFPT1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfpt1-protein-human.html

Purity

95.00

Smiles

QQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE

Molecular Formula

2673 (Gene_ID) Q06210-1/AAA58502.1 (Q332-E699) (Accession)

Molecular Weight

Approximately 41.5 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS1 Polyclonal Antibody, APC Conjugated
bs-9527R-APC 100 µL

ALAS1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Human ADP-ribose glycohydrolase OARD1 Protein
orb1475628-01 50 µg

Human ADP-ribose glycohydrolase OARD1 Protein

Sign In for Pricing
View Details
Human ADP-ribose glycohydrolase OARD1 Protein
orb1475628-02 500 µg

Human ADP-ribose glycohydrolase OARD1 Protein

Sign In for Pricing
View Details
MYL3 Antibody
22-388 100 µL

MYL3 Antibody

Sign In for Pricing
View Details
BIN3 (bridging integrator 3, MGC14978) (FITC)
243781-FITC 100 µL

BIN3 (bridging integrator 3, MGC14978) (FITC)

Sign In for Pricing
View Details
Zdhhc7 (NM_133394) Rat Tagged ORF Clone Lentiviral Particle
RR212748L3V 200 µL

Zdhhc7 (NM_133394) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details