Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OGT, Human (His)

OGT Protein, Human (His) is the recombinant human-derived OGT protein, expressed by E. coli, with N-6*His & N-SUMO tag.

Product Specifications

Product Name Alternative

OGT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/ogt-protein-human-his.html

Purity

95.00

Smiles

MAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQ

Molecular Formula

8473 (Gene_ID) O15294-1 (M606-Q1022) (Accession)

Molecular Weight

Approximately 68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perfluorohexanoic Acid (>90%)
TRC-P286525-2.5G 2.5 g

Perfluorohexanoic Acid (>90%)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF594 conjugate, 0.1mg/mL
BNC942560-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
0610038D11Rik (BC019418) Mouse Tagged ORF Clone
MG200396 10 µg

0610038D11Rik (BC019418) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Purified Anti-Human CD33 Antibody[6C5]
E-AB-F10830P-01 25 µg

Purified Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details
Purified Anti-Human CD33 Antibody[6C5]
E-AB-F10830P-02 100 µg

Purified Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details
APC Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986E-01 50 Tests

APC Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details