Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OGT, Human (His)

OGT Protein, Human (His) is the recombinant human-derived OGT protein, expressed by E. coli, with N-6*His & N-SUMO tag.

Product Specifications

Product Name Alternative

OGT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/ogt-protein-human-his.html

Purity

95.00

Smiles

MAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQ

Molecular Formula

8473 (Gene_ID) O15294-1 (M606-Q1022) (Accession)

Molecular Weight

Approximately 68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase beta (POLB) (NM_002690) Human Recombinant Protein
TP720137 10 µg

DNA Polymerase beta (POLB) (NM_002690) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant c-Myb Antibody
RC-15085-01 50 μL

Recombinant c-Myb Antibody

Sign In for Pricing
View Details
Recombinant c-Myb Antibody
RC-15085-02 100 µL

Recombinant c-Myb Antibody

Sign In for Pricing
View Details
Recombinant c-Myb Antibody
RC-15085-03 1 mL

Recombinant c-Myb Antibody

Sign In for Pricing
View Details
Recombinant EIF4E Antibody
RN-066-01 50 μL

Recombinant EIF4E Antibody

Sign In for Pricing
View Details
Recombinant EIF4E Antibody
RN-066-02 100 µL

Recombinant EIF4E Antibody

Sign In for Pricing
View Details