Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMO1, Human (HEK293)

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen’s eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

VMO1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vmo1-protein-human-hek293.html

Purity

95.00

Smiles

QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS

Molecular Formula

284013 (Gene_ID) Q7Z5L0-1 (Q25-S202) (Accession)

Molecular Weight

Approximately 19.7 kDa.

References & Citations

[1]Wang Z, et al. Vitelline membrane outer layer 1 homolog interacts with lysozyme C and promotes the stabilization of tear film. Invest Ophthalmol Vis Sci. 2014 Sep 25;55 (10) :6722-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRNP (TRNP1) activation kit by CRISPRa
GA117980 1 Kit

Human TRNP (TRNP1) activation kit by CRISPRa

Sign In for Pricing
View Details
2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody
TA364835 100 µL

2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCL2L2 (NM_004050) Human Recombinant Protein
TP311152M 100 µg

BCL2L2 (NM_004050) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Relaxin (RLN) ELISA Kit
RD-RLN-Mu-01 96 Tests

Mouse Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Mouse Relaxin (RLN) ELISA Kit
RD-RLN-Mu-02 48 Tests

Mouse Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
NPTX1 Rabbit Polyclonal Antibody
TA367161 100 µL

NPTX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details