Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMO1, Human (HEK293)

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen’s eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

VMO1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vmo1-protein-human-hek293.html

Purity

95.00

Smiles

QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS

Molecular Formula

284013 (Gene_ID) Q7Z5L0-1 (Q25-S202) (Accession)

Molecular Weight

Approximately 19.7 kDa.

References & Citations

[1]Wang Z, et al. Vitelline membrane outer layer 1 homolog interacts with lysozyme C and promotes the stabilization of tear film. Invest Ophthalmol Vis Sci. 2014 Sep 25;55 (10) :6722-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
Sugammadex Sodium-deuterated
TRC-S698102-25MG 25 mg

Sugammadex Sodium-deuterated

Sign In for Pricing
View Details
CELA3B (CELA3B/1218), Biotin conjugate, 0.1mg/mL
BNCB1218-500 1x 500 µL

CELA3B (CELA3B/1218), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SOS1 Antibody
RC-15578-01 50 μL

Recombinant SOS1 Antibody

Sign In for Pricing
View Details