Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMO1, Human (HEK293)

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen’s eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

VMO1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vmo1-protein-human-hek293.html

Purity

95.00

Smiles

QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS

Molecular Formula

284013 (Gene_ID) Q7Z5L0-1 (Q25-S202) (Accession)

Molecular Weight

Approximately 19.7 kDa.

References & Citations

[1]Wang Z, et al. Vitelline membrane outer layer 1 homolog interacts with lysozyme C and promotes the stabilization of tear film. Invest Ophthalmol Vis Sci. 2014 Sep 25;55 (10) :6722-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNAP2 CRISPRa sgRNA lentivector (set of three targets)(Human)
36212121 3x 1.0µg DNA

PCNAP2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
IL33 Rabbit pAb
E45R27954N-50 50 µL

IL33 Rabbit pAb

Sign In for Pricing
View Details
MUC8 Protein Vector (Human) (pPM-C-HA)
PV102968 500 ng

MUC8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SPRED2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2279106 1.0 µg DNA

SPRED2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Zebrafish CD36 Rabbit Polyclonal Antibody (Fluoro647)
orb3130357 100 µg

Zebrafish CD36 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Mouse Hypoxia Inducible Factor 1 Alpha (HIF1a) ELISA Kit
abx514031 96 Well

Mouse Hypoxia Inducible Factor 1 Alpha (HIF1a) ELISA Kit

Sign In for Pricing
View Details