Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Cynomolgus (HEK293, His)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-hek-293-his.html

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

Molecular Formula

/ (Gene_ID) G7PL88 (A37-S160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARA9 (AIP) Human Gene Knockout Kit (CRISPR)
KN211157RB 1 Kit

ARA9 (AIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Monoclonal Meprin alpha Subunit/MEP1A Antibody (364312) [Alexa Fluor 488]
FAB3220G 0.1 mL

Mouse Monoclonal Meprin alpha Subunit/MEP1A Antibody (364312) [Alexa Fluor 488]

Sign In for Pricing
View Details
THOP1 AAV Vector (Mouse) (CMV)
46665104 1 µg

THOP1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
GRB14 Polyclonal Antibody
UB-GEN-3824 100 µL

GRB14 Polyclonal Antibody

Sign In for Pricing
View Details
AHI1 siRNA (Human)
CRJ0228-01 15 nmol

AHI1 siRNA (Human)

Sign In for Pricing
View Details
AHI1 siRNA (Human)
CRJ0228-02 30 nmol

AHI1 siRNA (Human)

Sign In for Pricing
View Details