CTLA-4, Cynomolgus (HEK293, His)
CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CTLA-4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-hek-293-his.html
Smiles
AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS
Molecular Formula
/ (Gene_ID) G7PL88 (A37-S160) (Accession)
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Zfp622 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 1 (Tmco1), partial
Human Vascular Endothelial cell Growth Factor B, VEGF-B ELISA Kit
Human Vascular Endothelial cell Growth Factor B, VEGF-B ELISA Kit
Human Macrophage Inflammatory Protein 4 Alpha ELISA Kit (MIP4a)