Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Cynomolgus (HEK293, His)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-hek-293-his.html

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

Molecular Formula

/ (Gene_ID) G7PL88 (A37-S160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein patched homolog 2, PTC2 ELISA Kit
MBS9428510-01 96 Tests

Human Protein patched homolog 2, PTC2 ELISA Kit

Sign In for Pricing
View Details
Human Protein patched homolog 2, PTC2 ELISA Kit
MBS9428510-02 5x 96 Tests

Human Protein patched homolog 2, PTC2 ELISA Kit

Sign In for Pricing
View Details
Mouse monoclonal SAP30BP Antibody (OTI4H1)
NBP2-45686 0.1 mL

Mouse monoclonal SAP30BP Antibody (OTI4H1)

Sign In for Pricing
View Details
Anserini SDF4 ELISA Kit
EAS0083 96 Tests

Anserini SDF4 ELISA Kit

Sign In for Pricing
View Details
Human Protein INCA1, INCA1 ELISA KIT
ELI-12532h 96 Tests

Human Protein INCA1, INCA1 ELISA KIT

Sign In for Pricing
View Details
Mouse Cadherin 5 (CDH5) ELISA Kit
MBS2019729-01 24 Strip Well

Mouse Cadherin 5 (CDH5) ELISA Kit

Sign In for Pricing
View Details