Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Cynomolgus (HEK293, His)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-hek-293-his.html

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

Molecular Formula

/ (Gene_ID) G7PL88 (A37-S160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-RAD17 (Ser656) Antibody (R1F85)
RHB36501 100 μg

Anti-Phospho-RAD17 (Ser656) Antibody (R1F85)

Sign In for Pricing
View Details
RALB (Ras-Related Protein Ral-B)
406986-01 50 µL

RALB (Ras-Related Protein Ral-B)

Sign In for Pricing
View Details
RALB (Ras-Related Protein Ral-B)
406986-02 100 µL

RALB (Ras-Related Protein Ral-B)

Sign In for Pricing
View Details
Recombinant Human IGF1 Protein, N-His
HY095022-01 50 µg

Recombinant Human IGF1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IGF1 Protein, N-His
HY095022-02 100 µg

Recombinant Human IGF1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IGF1 Protein, N-His
HY095022-03 1 mg

Recombinant Human IGF1 Protein, N-His

Sign In for Pricing
View Details