CTLA-4, Cynomolgus (HEK293, His)
CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CTLA-4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-hek-293-his.html
Smiles
AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS
Molecular Formula
/ (Gene_ID) G7PL88 (A37-S160) (Accession)
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Ddb1 (NM_015735) Mouse Tagged ORF Clone Lentiviral Particle
FAAP24 (Fanconi Anemia-Associated Protein of 24kD, FAAP24, C19orf40) (FITC)
FAAP24 (Fanconi Anemia-Associated Protein of 24kD, FAAP24, C19orf40) (FITC)
Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB) (BSA & Azide Free)
Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB) (BSA & Azide Free)