Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Cynomolgus (HEK293, His)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-hek-293-his.html

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

Molecular Formula

/ (Gene_ID) G7PL88 (A37-S160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf98 (AK8) (NM_152572) Human Recombinant Protein
TP760797 50 µg

C9orf98 (AK8) (NM_152572) Human Recombinant Protein

Sign In for Pricing
View Details
Wnt8b Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6245R-BF750-01 20 µL

Wnt8b Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Wnt8b Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6245R-BF750-02 100 µL

Wnt8b Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
2''-O-Galloylhyperin 20mg
A15409-20 20 mg

2''-O-Galloylhyperin 20mg

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni smpB Protein (aa 1-150) (strain ATCC BAA-1458 / RM4099 / 269.97)
VAng-Ly2947-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni smpB Protein (aa 1-150) (strain ATCC BAA-1458 / RM4099 / 269.97)

Sign In for Pricing
View Details
Zfp462 3'UTR Luciferase Stable Cell Line
TU223759 1.0 mL

Zfp462 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details