Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Cynomolgus (HEK293, His)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-hek-293-his.html

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

Molecular Formula

/ (Gene_ID) G7PL88 (A37-S160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Repetin (RPTN) Human ELISA Kit
G7229 96 Tests

Repetin (RPTN) Human ELISA Kit

Sign In for Pricing
View Details
Nomo1 (BC033923) Mouse Tagged ORF Clone Lentiviral Particle
MR209861L3V 200 µL

Nomo1 (BC033923) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CYP19A1, CT (Cytochrome P450 19A1, CYPXIX, Estrogen Synthetase, P-450AROM, Aromatase, Cytochrome P-450AROM, ARO1, CYAR, CYP19) (HRP) discontinued
C9095-19W4-HRP 200 µL

CYP19A1, CT (Cytochrome P450 19A1, CYPXIX, Estrogen Synthetase, P-450AROM, Aromatase, Cytochrome P-450AROM, ARO1, CYAR, CYP19) (HRP) discontinued

Sign In for Pricing
View Details
BRUNOL6 antibody
70R-16033 50 ul

BRUNOL6 antibody

Sign In for Pricing
View Details
ITIH3 Polyclonal Antibody
E-AB-92966-01 60 µL

ITIH3 Polyclonal Antibody

Sign In for Pricing
View Details
ITIH3 Polyclonal Antibody
E-AB-92966-02 120 µL

ITIH3 Polyclonal Antibody

Sign In for Pricing
View Details