Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-13, Human (His)

Galectin-13 Protein, with beta-galactoside and lactose binding capacity, acts as a potent inducer of T-cell apoptosis, as confirmed by research findings. It also exhibits hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, maintained by disulfide linkages contributing to its dimeric form. Animal-Free Galectin-13 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-13 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-13-protein-human-his.html

Purity

95.00

Smiles

SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Molecular Formula

29124 (Gene_ID) Q9UHV8 (S2-N139) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-500 1x 500 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF640R conjugate, 0.1mg/mL
BNC401422-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details