Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glycoprotein D/gD, HHV-2 (Cell-Free, His)

Glycoprotein D/gD proteins bind to host cell receptors TNFRSF14/HVEM and NECTIN1, triggering fusion with the host membrane by recruiting gB and gH/gL. glycoprotein D/gD Protein, HHV-2 (Cell-Free, His) is the recombinant Virus-derived glycoprotein D/gD protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

Glycoprotein D/gD Protein, HHV-2 (Cell-Free, His), Virus, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/glycoprotein-d-gd-protein-hhv-2-cf-his.html

Smiles

KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY

Molecular Formula

1487358 (Gene_ID) Q69467 (K26-Y393) (Accession)

Molecular Weight

42.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-500 1x 500 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-100 1x 100 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), CF488A conjugate, 0.1mg/mL
BNC881135-100 1x 100 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details