Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLXDC2, Mouse (HEK293, His)

The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLXDC2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plxdc2-protein-mouse-hek-293-his.html

Purity

98.00

Smiles

EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHA

Molecular Formula

67448 (Gene_ID) Q9DC11 (E31-A455) (Accession)

Molecular Weight

Approximately 70-96 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WDR93 CRISPRa sgRNA lentivector (set of three targets)(Human)
50386121 3x 1.0µg DNA

WDR93 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
Nek6, CT (Nek6, Serine/threonine-protein kinase Nek6, Never in mitosis A-related kinase 6) (MaxLight 550) discontinued
038888-ML550 100 µL

Nek6, CT (Nek6, Serine/threonine-protein kinase Nek6, Never in mitosis A-related kinase 6) (MaxLight 550) discontinued

Ask
View Details
CD168 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61272R-BF750-01 20 µL

CD168 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Ask
View Details
CD168 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61272R-BF750-02 100 µL

CD168 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Ask
View Details
Nori® Turkey BMP3 ELISA Kit
GR187031 96 Well

Nori® Turkey BMP3 ELISA Kit

Ask
View Details
AATF Antibody
MBS8587660-01 0.1 mg

AATF Antibody

Ask
View Details