Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLXDC2, Mouse (HEK293, His)

The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLXDC2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plxdc2-protein-mouse-hek-293-his.html

Purity

98.00

Smiles

EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHA

Molecular Formula

67448 (Gene_ID) Q9DC11 (E31-A455) (Accession)

Molecular Weight

Approximately 70-96 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human POU2F2 sgRNA gene knockout kit - Lentiviral human POU2F2 sgRNA gene knockout kit (100)
GTR15391483 1 Vial

Lentiviral human POU2F2 sgRNA gene knockout kit - Lentiviral human POU2F2 sgRNA gene knockout kit (100)

Ask
View Details
Human B3GAT3 Protein Lysate
MBS137803-01 0.02 mg

Human B3GAT3 Protein Lysate

Ask
View Details
Human B3GAT3 Protein Lysate
MBS137803-02 5x 0.02 mg

Human B3GAT3 Protein Lysate

Ask
View Details
Rat Nrf2 ELISA Kit (Colorimetric)
NBP3-08161 1 Kit

Rat Nrf2 ELISA Kit (Colorimetric)

Ask
View Details
KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (APC)
MBS6484559-01 0.2 mL

KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (APC)

Ask
View Details
KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (APC)
MBS6484559-02 5x 0.2 mL

KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (APC)

Ask
View Details