Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 beta/CXCL12, Human (HEK293, Fc)

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells[1][2]. SDF-1 beta/CXCL12 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 72 amino acids (K22-M93) .

Product Specifications

Product Name Alternative

SDF-1 beta/CXCL12 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sdf-1-protein-human-hek293-fc.html

Purity

95.00

Smiles

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Molecular Formula

6387 (Gene_ID) P48061-1 (K22-M93) (Accession)

Molecular Weight

Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Maria De La Luz Sierra, et al. Differential processing of stromal-derived factor-1alpha and stromal-derived factor-1beta explains functional diversity. Blood. 2004 Apr 1;103 (7) :2452-9.|[2]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[3]Miroslaw Janowski. Functional diversity of SDF-1 splicing variants. Cell Adh Migr. 2009 Jul-Sep;3 (3) :243-9.|[4]Kleanthis Fytianos, et al. Anti-Fibrotic Effect of SDF-1β Overexpression in Bleomycin-Injured Rat Lung. Pharmaceutics. 2022 Aug 27;14 (9) :1803.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc2 (BC099427) Mouse Tagged ORF Clone Lentiviral Particle
MR201500L3V 200 µL

Wfdc2 (BC099427) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Fanconi Anemia Group M Protein (FANCM) Antibody
abx375541 100 µg

Fanconi Anemia Group M Protein (FANCM) Antibody

Sign In for Pricing
View Details
Myomodulin Peptide
PE-55266-01 1 mg

Myomodulin Peptide

Sign In for Pricing
View Details
Myomodulin Peptide
PE-55266-02 5 mg

Myomodulin Peptide

Sign In for Pricing
View Details
Myomodulin Peptide
PE-55266-03 10 mg

Myomodulin Peptide

Sign In for Pricing
View Details
SET / TAF-I Rabbit mAb
C06623-20uL 20 µL

SET / TAF-I Rabbit mAb

Sign In for Pricing
View Details