Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Mouse (HEK293, His)

The NXPH1 protein is similar to a neuropeptide, acting as a signaling molecule and acting as a ligand for alpha-neurotoxins.Its role in cell signaling, influencing neural communication through alpha-neurotoxin interactions, highlights its involvement in complex molecular processes and suggests that it plays a key role in regulating cellular functions in neurobiology.NXPH1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-mouse-hek293-his.html

Purity

93.50

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

18231 (Gene_ID) Q61200 (A22-G271) (Accession)

Molecular Weight

Approximately 40-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details