Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Mouse (HEK293, His)

The NXPH1 protein is similar to a neuropeptide, acting as a signaling molecule and acting as a ligand for alpha-neurotoxins.Its role in cell signaling, influencing neural communication through alpha-neurotoxin interactions, highlights its involvement in complex molecular processes and suggests that it plays a key role in regulating cellular functions in neurobiology.NXPH1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-mouse-hek293-his.html

Purity

93.50

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

18231 (Gene_ID) Q61200 (A22-G271) (Accession)

Molecular Weight

Approximately 40-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINF1 antibody - N-terminal region (AVARP20020_P050)
AVARP20020_P050 100 µL

SERPINF1 antibody - N-terminal region (AVARP20020_P050)

Sign In for Pricing
View Details
Hephaestin Rabbit pAb
E47R15458 100 µL

Hephaestin Rabbit pAb

Sign In for Pricing
View Details
Anthraflavic acid
orb1301391-01 100 mg

Anthraflavic acid

Sign In for Pricing
View Details
Anthraflavic acid
orb1301391-02 1 ml x 10 mM (in DMSO)

Anthraflavic acid

Sign In for Pricing
View Details
Rat Coxsackie Virus and AdenoVirus Receptor ELISA Kit
MBS054839-01 48 Well

Rat Coxsackie Virus and AdenoVirus Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Coxsackie Virus and AdenoVirus Receptor ELISA Kit
MBS054839-02 96 Well

Rat Coxsackie Virus and AdenoVirus Receptor ELISA Kit

Sign In for Pricing
View Details