Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Monoclonal IL6R Antibody (OTI2F4) [Biotin]

Product Specifications

CAS Number

9007-83-4

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB33B Human qPCR Primer Pair (NM_031296)
HP215552 200 Reactions

RAB33B Human qPCR Primer Pair (NM_031296)

Sign In for Pricing
View Details
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
MBS5818107 Inquire

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
Chu (N6) Medium
30630007-2 25 L

Chu (N6) Medium

Sign In for Pricing
View Details
KAT7 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61637R-PE-Cy5.5 100 µL

KAT7 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Olfr126 3'UTR GFP Stable Cell Line
TU164768 1.0 mL

Olfr126 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat POU Domain, Class 2, Transcription Factor 1 / OCT1 (POU2F1) ELISA Kit
abx539480 96 Tests

Rat POU Domain, Class 2, Transcription Factor 1 / OCT1 (POU2F1) ELISA Kit

Sign In for Pricing
View Details