Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Azurocidin, Human (HEK293, His)

Azurocidin Protein, Human (HEK293, His), a recombinant human Azurocidin produced in HEK293 cells, has a His tag. Azurocidin is a protein that is mobilized rapidly from emigrating polymorphonuclear leukocytes (PMN) . Azurocidin serves as an important mediator during the initiation of the immune response[1].

Product Specifications

Product Name Alternative

Azurocidin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/azurocidin-protein-human-hek293-his.html

Purity

98.0

Smiles

IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGP

Molecular Formula

566 (Gene_ID) P20160 (I27-P250) (Accession)

Molecular Weight

Approximately 35-44 kDa due to the glycosylation.

References & Citations

[1]Oliver Soehnlein, et al. Neutrophil-derived azurocidin alarms the immune system. J Leukoc Biol. 2009 Mar;85 (3) :344-51.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NELFB (Negative Elongation Factor B, NELF-B, Cofactor of BRCA1, COBRA1, KIAA1182, RP13-122B23.3) (HRP)
132736-HRP 100 µL

NELFB (Negative Elongation Factor B, NELF-B, Cofactor of BRCA1, COBRA1, KIAA1182, RP13-122B23.3) (HRP)

Sign In for Pricing
View Details
VGLL1 Rabbit pAb, Pacific Blue conjugated
orb2888701 100 µL

VGLL1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Rat Cytidine deaminase (CDA) ELISA Kit
MBS7233047-01 48 Well

Rat Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details
Rat Cytidine deaminase (CDA) ELISA Kit
MBS7233047-02 96 Well

Rat Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details
Rat Cytidine deaminase (CDA) ELISA Kit
MBS7233047-03 5x 96 Well

Rat Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details
Rat Cytidine deaminase (CDA) ELISA Kit
MBS7233047-04 10x 96 Well

Rat Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details