Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Spike glycoprotein (S), partial

Product Specifications

Product Name Alternative

S glycoprotein; E2; Peplomer protein

Abbreviation

Recombinant Bovine coronavirus S protein, partial

Gene Name

S

UniProt

Q9QAQ8

Expression Region

314-634aa

Organism

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Target Sequence

TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSIWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCHNAAQCGCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCSCRPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein & Coronavirus Protein

Source

Yeast

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wscd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50471114 3x 1.0 µg

Wscd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Zbtb20 Pre-designed siRNA Set B
SI116228B 1 Each

Mouse Zbtb20 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse anti Human CD45RA
045R1 100 µg

Mouse anti Human CD45RA

Sign In for Pricing
View Details
MBL Plus ESBL ?Detection Strip
EM134-120ST 1 unit

MBL Plus ESBL ?Detection Strip

Sign In for Pricing
View Details
TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Biotin)
MBS6358178-01 0.2 mL

TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Biotin)

Sign In for Pricing
View Details
TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Biotin)
MBS6358178-02 5x 0.2 mL

TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Biotin)

Sign In for Pricing
View Details