Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCR-BluntII-TOPO-Smc1a-m Plasmid
PVT21508 2 µg

pCR-BluntII-TOPO-Smc1a-m Plasmid

Sign In for Pricing
View Details
OXCT1 (Succinyl-CoA:3-Ketoacid Coenzyme A Transferase 1, Mitochondrial, 3-Oxoacid CoA-Transferase 1, Somatic-Type Succinyl-CoA:3-Oxoacid CoA-Transferase, SCOT-s, OXCT1, OXCT, SCOT) (MaxLight 750) discontinued
302629-ML750 100 µL

OXCT1 (Succinyl-CoA:3-Ketoacid Coenzyme A Transferase 1, Mitochondrial, 3-Oxoacid CoA-Transferase 1, Somatic-Type Succinyl-CoA:3-Oxoacid CoA-Transferase, SCOT-s, OXCT1, OXCT, SCOT) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human NGFI-A-binding protein 1 (NAB1) ELISA Kit
abx385221 96 Tests

Human NGFI-A-binding protein 1 (NAB1) ELISA Kit

Sign In for Pricing
View Details
POSH Antibody
MBS9521880-01 0.04 mL

POSH Antibody

Sign In for Pricing
View Details
POSH Antibody
MBS9521880-02 0.1 mL

POSH Antibody

Sign In for Pricing
View Details
POSH Antibody
MBS9521880-03 0.2 mL

POSH Antibody

Sign In for Pricing
View Details