Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gspt1 (NM_146066) Mouse Tagged Lenti ORF Clone
MR209166L3 10 µg

Gspt1 (NM_146066) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1265-01 50 μL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1265-02 100 µL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1265-03 1 mL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD14 Antibody (134620) [mFluor Violet 500 SE]
FAB3832MFV500 0.1 mL

Mouse Monoclonal CD14 Antibody (134620) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Grant JB Nova 26L digital water bath with Polycarbonate lid
BAT3320 1 Each

Grant JB Nova 26L digital water bath with Polycarbonate lid

Sign In for Pricing
View Details