Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA (aa 16-546)(B/Colorado/06/2017)
MBS430291-01 0.05 mg

HA (aa 16-546)(B/Colorado/06/2017)

Sign In for Pricing
View Details
HA (aa 16-546)(B/Colorado/06/2017)
MBS430291-02 5x 0.05 mg

HA (aa 16-546)(B/Colorado/06/2017)

Sign In for Pricing
View Details
Top1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7105508 1.0 µg DNA

Top1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
PCMV-CD274-6xHis-Neo Plasmid
PVT71253 2 µg

PCMV-CD274-6xHis-Neo Plasmid

Sign In for Pricing
View Details
Efr3a Rat shRNA Lentiviral Particle (Locus ID 362923)
TL708577V 500 µL Each

Efr3a Rat shRNA Lentiviral Particle (Locus ID 362923)

Sign In for Pricing
View Details
Recombinant Mouse CCDC62 Protein, His (Fc)-Avi-tagged
CCDC62-1352M 50 µg

Recombinant Mouse CCDC62 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details