Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COLEC11, NT (Collectin-11, Collectin Kidney Protein 1, CL-K1, UNQ596/PRO1182) (HRP) discontinued
C7549-80-HRP 200 µL

COLEC11, NT (Collectin-11, Collectin Kidney Protein 1, CL-K1, UNQ596/PRO1182) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal BMP-15/GDF-9B Antibody ([28A]) [DyLight 550]
NBP2-61935R 0.1 mL

Mouse Monoclonal BMP-15/GDF-9B Antibody ([28A]) [DyLight 550]

Sign In for Pricing
View Details
TIP120B (CAND2) (NM_012298) Human Tagged Lenti ORF Clone
RC216536L4 10 µg

TIP120B (CAND2) (NM_012298) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human CD16a/FCGR3A (F176) Protein, C-His (Active)
AHC35005 100 μg

Recombinant Human CD16a/FCGR3A (F176) Protein, C-His (Active)

Sign In for Pricing
View Details
VPS29 ORF Vector (Human) (pORF)
50179011 1.0 µg DNA

VPS29 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Factor Related Apoptosis Ligand (FASL) ELISA Kit
RD-FASL-Mu-01 96 Tests

Mouse Factor Related Apoptosis Ligand (FASL) ELISA Kit

Sign In for Pricing
View Details