Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propyl Pentanoate
RG-A263411-01 10 mg

Propyl Pentanoate

Sign In for Pricing
View Details
Propyl Pentanoate
RG-A263411-02 25 mg

Propyl Pentanoate

Sign In for Pricing
View Details
Propyl Pentanoate
RG-A263411-03 50 mg

Propyl Pentanoate

Sign In for Pricing
View Details
Propyl Pentanoate
RG-A263411-04 100 mg

Propyl Pentanoate

Sign In for Pricing
View Details
Rabbit Monoclonal gamma-Synuclein Antibody (SAIC-31A-10) [mFluor Violet 500 SE]
NBP3-20099MFV500 0.1 mL

Rabbit Monoclonal gamma-Synuclein Antibody (SAIC-31A-10) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Human Influenza viruses B, FLU B ELISA Kit
NSL2439Hu 96 Tests

Human Influenza viruses B, FLU B ELISA Kit

Sign In for Pricing
View Details