Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNA14 (NM_004297) Human Tagged ORF Clone Lentiviral Particle
RC206547L4V 200 µL

GNA14 (NM_004297) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant CD163 Antibody
V8757-100UG 100 µg

Recombinant CD163 Antibody

Sign In for Pricing
View Details
SOX10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45133061 1.0 µg DNA

SOX10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127706) Human Tagged ORF Clone Lentiviral Particle
RC225663L3V 200 µL

alpha 1 Antitrypsin (SERPINA1) (NM_001127706) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HACE1 (NM_020771) Human Recombinant Protein
PH39290M5 20 µg

HACE1 (NM_020771) Human Recombinant Protein

Sign In for Pricing
View Details
CLGN Over-expression Lysate Product
GWB-D3B11B 0.1 mg

CLGN Over-expression Lysate Product

Sign In for Pricing
View Details